DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RHBDF1

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006720984.1 Gene:RHBDF1 / 64285 HGNCID:20561 Length:878 Species:Homo sapiens


Alignment Length:167 Identity:43/167 - (25%)
Similarity:72/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVD 193
            |||..:||..|   .|||..||...::..|:.....||.:.|..|..:||:...:.|:|.     
Human   673 PDQFYRLWLSL---FLHAGILHCLVSICFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLA----- 729

  Fly   194 SEVFL-----VGASGGVYALLAAQLASLLLNF---GQMRHGVIQLMAVILFVFCDLGYALYSREL 250
            |.:||     ||.:|..:.:||.....|..::   .:......:|:||:||:|.   :.|.    
Human   730 SAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFT---FGLL---- 787

  Fly   251 AMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGG 287
                    |.:...||::|.::|:.:....|..:..|
Human   788 --------PWIDNFAHISGFISGLFLSFAFLPYISFG 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 41/160 (26%)
RHBDF1XP_006720984.1 Rhomboid_SP 114..331 CDD:403706
Rhomboid 670..811 CDD:396315 41/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.