DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdl2

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001016521.1 Gene:rhbdl2 / 549275 XenbaseID:XB-GENE-992044 Length:290 Species:Xenopus tropicalis


Alignment Length:304 Identity:106/304 - (34%)
Similarity:156/304 - (51%) Gaps:58/304 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EMPPSTVLQMPPAPLSSKSGLVLGVCCDQLMAVQPVQRASGAAATKSNSPDW---GNHRAKHHE- 87
            |.||.|                   |||::            ..|.||   |   .|.|..:.| 
 Frog    22 ESPPKT-------------------CCDKI------------HETISN---WILPTNQRDTYLER 52

  Fly    88 GSAAPFKWIPPFFIILATLLEVLVFLWVGADPPE-----------DSLLVYRPDQRLQLWRFLSY 141
            .:..|    ||.|||..::.|:.||::.....|:           :|..:||||:|.:.|||:||
 Frog    53 ANCLP----PPIFIISVSIAELAVFIYYAVWMPQKQWITLDTGVWNSPFIYRPDKREEAWRFISY 113

  Fly   142 ALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVY 206
            .::||...|:..|:..|||.|:||||||...|.|::|:|||:.|||.:||.||.:.|||||||||
 Frog   114 MMVHAGVQHIIGNLALQLLLGIPLELVHKGHRIGLVYLAGVIGGSLASSVFDSGLALVGASGGVY 178

  Fly   207 ALLAAQLASLLLNFGQM--RHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSVSYIAHMTG 269
            ||:.....::|:||..|  ..|:.:::.:|..|..|:|:|||.|.:: |  :|...||::||..|
 Frog   179 ALIGGYFMNVLVNFKDMIPLFGIFRILVIITIVGTDVGFALYRRYIS-H--ETGQKVSFVAHFAG 240

  Fly   270 ALAGISVGLLLLRQLDGGLRPRPLRWLALGVWCIFSAFGIAFNL 313
            .|||:|:|..:....|..|...|..|:.:..:..|..|.:.||:
 Frog   241 GLAGMSIGYTVFSCFDKNLIKDPRFWICIAAYAAFVIFAVLFNI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 71/154 (46%)
rhbdl2NP_001016521.1 Rhomboid 103..252 CDD:366759 69/151 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.