DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and parla

DIOPT Version :10

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001014320.1 Gene:parla / 541485 ZFINID:ZDB-GENE-050327-8 Length:383 Species:Danio rerio


Alignment Length:142 Identity:38/142 - (26%)
Similarity:60/142 - (42%) Gaps:26/142 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 HASWLHLGYNVLTQLLFG------------VPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVF 197
            |.|.:|:..|:.....|.            :.|.|..|.:.|.|.|:.....|.||.|       
Zfish   217 HYSVIHMVVNMYVLWTFSSSIVSLLGREQFLALYLSGGVISTFVSYVFKTATGRLGPS------- 274

  Fly   198 LVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSVS 262
             :||||.:..:|||    :.....:.:.|:: |:.||.|...:...||.:.::|...|..| ...
Zfish   275 -LGASGSIMTVLAA----VCTKIPEAKLGIV-LLPVISFSAGNALKALVALDIAGLVLGWR-FFD 332

  Fly   263 YIAHMTGALAGI 274
            :.||:.|||.|:
Zfish   333 HAAHLGGALFGV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..283 CDD:426384 38/142 (27%)
parlaNP_001014320.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..75
Rhomboid 210..351 CDD:426384 38/142 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.