DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and Parl

DIOPT Version :10

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001005767.1 Gene:Parl / 381038 MGIID:1277152 Length:377 Species:Mus musculus


Alignment Length:146 Identity:39/146 - (26%)
Similarity:59/146 - (40%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLV 199
            ||.|.|..:          |:|.|..| |.:.|..|.:...|.|:..|..|..|.|        :
Mouse   227 LWSFSSSIV----------NILGQEQF-VAVYLSAGVISNFVSYVCKVATGRYGPS--------L 272

  Fly   200 GASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSV--- 261
            ||||.:..:|||...       ::..|.:.::.:.:|.| ..|.||    .|:..:.|...:   
Mouse   273 GASGAIMTVLAAVCT-------KIPEGRLAIIFLPVFTF-TAGNAL----KAIIAMDTAGMILGW 325

  Fly   262 ---SYIAHMTGALAGI 274
               .:.||:.|||.||
Mouse   326 KFFDHAAHLGGALFGI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..283 CDD:426384 39/146 (27%)
ParlNP_001005767.1 Rhomboid 207..348 CDD:426384 39/146 (27%)

Return to query results.
Submit another query.