DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and Rhbdf1

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_038941805.1 Gene:Rhbdf1 / 303008 RGDID:1305075 Length:907 Species:Rattus norvegicus


Alignment Length:167 Identity:44/167 - (26%)
Similarity:72/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVD 193
            |||..:||..|   .|||..||...:|..|:.....||.:.|..|..:||:...:.|:|.     
  Rat   702 PDQFYRLWLSL---FLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGVTGNLA----- 758

  Fly   194 SEVFL-----VGASGGVYALLAAQLASLLLNF---GQMRHGVIQLMAVILFVFCDLGYALYSREL 250
            |.:||     ||.:|..:.:||.....|..::   .:......:|:||:||:|   .:.|.    
  Rat   759 SAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLF---AFGLL---- 816

  Fly   251 AMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGG 287
                    |.:...||::|.::|:.:....|..:..|
  Rat   817 --------PWIDNFAHISGFVSGLFLSFAFLPYISFG 845

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 42/160 (26%)
Rhbdf1XP_038941805.1 Rhomboid_SP 142..359 CDD:403706
Rhomboid 699..840 CDD:396315 42/160 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.