DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and Rhbdl2

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_038965543.1 Gene:Rhbdl2 / 298512 RGDID:1308295 Length:302 Species:Rattus norvegicus


Alignment Length:234 Identity:91/234 - (38%)
Similarity:137/234 - (58%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PPFFIILATLLEVLVFLWVGADPPE-----------DSLLVYRPDQRLQLWRFLSYALLHASWLH 150
            ||.||:|.:|.|:.||::.....|:           :|.|.|||::|.:.|||:||.|:||...|
  Rat    70 PPLFIVLISLAELAVFIYYAVWKPQKQWITLDTGILESPLTYRPEKREEAWRFISYMLVHAGVQH 134

  Fly   151 LGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLAS 215
            :..|:..||:.|:|||:||..||.|::|:||||||||.:|:.|....|||||||||||:.....:
  Rat   135 IVGNLFMQLVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDPLKSLVGASGGVYALMGGYFMN 199

  Fly   216 LLLNFGQM--RHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPS----VSYIAHMTGALAGI 274
            :::||.:|  ..|:::|:.:||.|..|:|:|||.|...       |:    ||:.||:.|..||:
  Rat   200 VIVNFREMIPALGIVRLLVIILIVASDMGFALYRRFFV-------PANGSPVSFAAHIAGGFAGM 257

  Fly   275 SVGLLLLRQLDGGLRPRPLRWLALGVWCIFSAFGIAFNL 313
            |||..:....|..|...|..|:::..:.....|.:.||:
  Rat   258 SVGYTVFSCFDKTLLKDPRFWISIAAYVACLLFAVFFNI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 70/158 (44%)
Rhbdl2XP_038965543.1 Rhomboid 113..265 CDD:396315 70/158 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.