DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and Rhbdl3

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:279 Identity:78/279 - (27%)
Similarity:105/279 - (37%) Gaps:90/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GRRPKNRPLIGTVEEG----EMPPSTVLQMPPAP---------------------------LSSK 44
            |..|...|.:....|.    |:.|....::|.||                           |.|.
Mouse     2 GEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFRSLLESH 66

  Fly    45 SG----------LVL------GVCCDQ----LMA-----------VQPVQRASGAAATKSNSPDW 78
            |.          |.|      |..|.|    ||:           :|..:|.|..|..:......
Mouse    67 SSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSL 131

  Fly    79 GNHRAKHHEGSAAP----FKWI--------PPFFIILATLLEVLVFLWVGADPPEDSL------- 124
            .....:|......|    .||.        ||:|:|..|||||.:||:.|....:..|       
Mouse   132 SQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVTHPRY 196

  Fly   125 ----LVYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAG 185
                |||.|..|.|.||:::|..:||....||.||..|||.|||||:|||:.|.|::|:|||:| 
Mouse   197 LKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVA- 260

  Fly   186 SLGTSVVDSEVFLVGASGG 204
                .:|..||.:..|:.|
Mouse   261 ----ELVRHEVPVQAAADG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 35/76 (46%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618 9/63 (14%)
Rhomboid 207..>260 CDD:389796 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834621
Domainoid 1 1.000 142 1.000 Domainoid score I4661
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.