DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rom-2

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:229 Identity:70/229 - (30%)
Similarity:112/229 - (48%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PPFFIILATLLEVLVFL----------WVGADPPEDSLLVYRPDQRLQLWRFLSYALLHASWLHL 151
            ||.|:|..:::::..:|          |:....|..|.|:.......:|||..:|.|::....|:
 Worm   121 PPIFLIFLSIVQLAFYLYYVVDSSEGVWLSGPIPTMSPLIVSQYHLPELWRLFTYCLINVGIFHI 185

  Fly   152 GYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASL 216
            .:|:|.||..|||||||| ..|..::|..|||.||:.:..:|..|||.|.:.|.::|:|:.:.::
 Worm   186 IFNILIQLAIGVPLELVH-RWRIYILYFMGVLFGSILSLALDPTVFLCGGAAGSFSLIASHITTI 249

  Fly   217 LLNFGQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRP---SVSYIAHMTGALAGISVGL 278
            ..||.:|.:...:|..:|:|...|...|:|.|..|       |   .||...|:.|.:|||....
 Worm   250 ATNFKEMENATCRLPILIVFAALDYVLAVYQRFFA-------PRIDKVSMYGHLGGLVAGILFTF 307

  Fly   279 LLLRQLDGGLRPRPLRWLALGVW--CIFSAFGIA 310
            :|.|      ..:|.|:..:..|  .:.|.|.||
 Worm   308 ILFR------GSKPSRFYTVSFWVSLVLSGFFIA 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 53/155 (34%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:404394
Rhomboid 165..311 CDD:396315 53/153 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.