DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and RHBDL3

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001350764.1 Gene:RHBDL3 / 162494 HGNCID:16502 Length:428 Species:Homo sapiens


Alignment Length:148 Identity:58/148 - (39%)
Similarity:80/148 - (54%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KWI--------PPFFIILATLLEVLVFLWVGADPPEDSL-----------LVYRPDQRLQLWRFL 139
            ||.        ||:|:|..|||||..||:.|....:..|           |||.|..|.|:||:|
Human   151 KWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYL 215

  Fly   140 SYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFLVGASGG 204
            :|..:||...|||.||:.|||.|||||:|||:.|.|::|:|||:|     .:|..||.:..|:.|
Human   216 TYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVA-----ELVRHEVPVQAAADG 275

  Fly   205 V------YALLAAQLASL 216
            .      :.:.|.::|.|
Human   276 CGPYLYEHGVWAGRVAPL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 40/94 (43%)
RHBDL3NP_001350764.1 EF-hand_7 36..100 CDD:316058
EF-hand motif 38..67 CDD:320054
Rhomboid 205..>260 CDD:328780 31/54 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144493
Domainoid 1 1.000 148 1.000 Domainoid score I4469
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45840
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.