powered by:
Protein Alignment ru and Rhbdf1
DIOPT Version :9
Sequence 1: | NP_524790.1 |
Gene: | ru / 44856 |
FlyBaseID: | FBgn0003295 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036012182.1 |
Gene: | Rhbdf1 / 13650 |
MGIID: | 104328 |
Length: | 926 |
Species: | Mus musculus |
Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
Similarity: | 32/63 - (50%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSV 191
|||..:||..| .|||..||...:|..|:.....||.:.|..|..:||:...:.|:|.:::
Mouse 699 PDQFYRLWLSL---FLHAGILHCLVSVCFQMTVLRDLEKLAGWHRIAIIYLLSGITGNLASAI 758
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0705 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1253228at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X418 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.