DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdl3

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031750644.1 Gene:rhbdl3 / 101732375 -ID:- Length:350 Species:Xenopus tropicalis


Alignment Length:339 Identity:115/339 - (33%)
Similarity:166/339 - (48%) Gaps:68/339 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MPPAP-LSSKSGLVLGVCC-------DQLMAVQPVQRASGAAATKSNSPD--------WGNHR-- 82
            ||.|| :|:.|.  .|:||       .......|...   ||.|.||...        .|||:  
 Frog     1 MPTAPAISAPSS--SGLCCTCRIWTHTSWTCYWPWHT---AALTMSNKRSNSFRRAILQGNHQLR 60

  Fly    83 ----------------AKHHEGSAAP----FKWI--------PPFFIILATLLEVLVFLWVG--- 116
                            .:|......|    .||.        ||:|||..|::||..|::.|   
 Frog    61 NKALLEESGLSLTQRFIRHMAYETLPREIDRKWFYDNYTGCPPPWFIITVTIVEVAAFVYYGLVL 125

  Fly   117 ------ADPP---EDSLLVYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSL 172
                  |..|   .::.|||.|..|:|.||:|||..:||...|||.||..|||.|||||:|||::
 Frog   126 DRFVLQATHPRYLRNNPLVYHPQVRVQAWRYLSYMFMHAGIEHLGVNVALQLLVGVPLEMVHGAV 190

  Fly   173 RTGVIYMAGVLAGSLGTSVVDSEVFLVGASGGVYALLAAQLASLLLNFGQMRHGVIQLMAVILFV 237
            |...:|:||:|||||..||.|:....||||.||||||:|.||::::|:..|: ...:|:.....:
 Frog   191 RISFVYIAGILAGSLAVSVADTSAPAVGASAGVYALLSAHLANIVMNWSGMK-CQFKLLRTAFAL 254

  Fly   238 FC---DLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGGLRPRPLRWLALG 299
            .|   :.|.|::.| |........|..|::||:.|.|.||::|::.||..:..||.:.|.|:.|.
 Frog   255 ICMSFEFGRAVWLR-LYPSAYAPCPHPSFVAHLGGVLVGITLGVITLRNYEQRLRDQSLWWVFLA 318

  Fly   300 VWCIFSAFGIAFNL 313
            ::.:|..|.:.:|:
 Frog   319 IYVLFVTFAVLWNI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 68/155 (44%)
rhbdl3XP_031750644.1 Rhomboid 152..301 CDD:396315 66/150 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I4466
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 1 1.000 - - FOG0000995
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.