DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdf1

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_004917997.1 Gene:rhbdf1 / 100494777 XenbaseID:XB-GENE-6083739 Length:892 Species:Xenopus tropicalis


Alignment Length:328 Identity:66/328 - (20%)
Similarity:104/328 - (31%) Gaps:126/328 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CC---DQLMAVQPVQRASGAA-------ATKSNSPDWGNHRAKH-----HE--------GSAAPF 93
            ||   |:...:|..:....:.       .|.|::|:..|..|:|     |:        .|..|.
 Frog   537 CCVRNDKSGCIQTSEEECSSTLAVWVKWPTHSSTPELANKSARHSGSVCHQDPRFCAEPASVTPH 601

  Fly    94 KW---------------------------------------------------IPPFFIILATLL 107
            :|                                                   :..:|...|||.
 Frog   602 EWPDDITKWPVCTKNSDGHFPNHLHMDCVITGRPCCIGTKGRCEITSREYCDFMKGYFHEEATLC 666

  Fly   108 E----------VLVFLWVGADPPEDSLLVYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFG 162
            .          :|.||    ||.       .|||..:||..|   .|||..||...:|..|:...
 Frog   667 SQVHCMDDVCGLLPFL----DPE-------FPDQVYRLWLSL---FLHAGVLHCLVSVCFQMTIL 717

  Fly   163 VPLELVHGSLRTGVIYMAGVLAGSLGTSVVDSEVFL-----VGASGGVYALLAAQLASLLLNF-- 220
            ..||.:.|..|..:||:...:.|:|     .|.:||     ||.:|..:.:||.....|..::  
 Frog   718 RDLEKLAGWHRISIIYILSGITGNL-----TSAIFLPYRAEVGPAGSQFGILACLFVELFQSWQI 777

  Fly   221 -GQMRHGVIQLMAVILFVFCDLGYALYSRELAMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQL 284
             .:......:|.||::|:|.   :.|.            |.:...||..|.::|..:....|..:
 Frog   778 LARPWRAFFKLFAVVIFLFT---FGLL------------PWIDNFAHFAGFVSGFFLSFAFLPYI 827

  Fly   285 DGG 287
            ..|
 Frog   828 SFG 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 41/160 (26%)
rhbdf1XP_004917997.1 Rhomboid_SP 127..345 CDD:372211
Rhomboid 687..827 CDD:366759 42/162 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.