DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ru and rhbdf2

DIOPT Version :9

Sequence 1:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001090673.1 Gene:rhbdf2 / 100036646 XenbaseID:XB-GENE-966769 Length:826 Species:Xenopus tropicalis


Alignment Length:185 Identity:49/185 - (26%)
Similarity:82/185 - (44%) Gaps:35/185 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTSVVD 193
            |||..:||..|   .|||..:|...:|:.|:.....||.:.|.||..:||:...:.|:|.     
 Frog   621 PDQFYRLWLSL---FLHAGVIHCCVSVVFQMTVLRDLEKLAGWLRISIIYILSGITGNLA----- 677

  Fly   194 SEVFL-----VGASGGVYALLAAQLASLLLNF---GQMRHGVIQLMAVILFVFCDLGYALYSREL 250
            |.:||     ||.:|..:.|||.....|..::   .:.....::|:.::||:|.   :.|.    
 Frog   678 SALFLPYRAEVGPAGSQFGLLACLFVELFQSWQILAKPWKAFLKLLGIVLFLFL---FGLL---- 735

  Fly   251 AMHQLQTRPSVSYIAHMTGALAGISVGLLLLRQLDGG----LRPRPLRWLALGVW 301
                    |.:..|||:.|.|:|:.:....|..:..|    .|.|.:..::|.|:
 Frog   736 --------PWIDNIAHIFGFLSGLLLSFSFLPYITFGTADKFRKRAMIIISLLVF 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ruNP_524790.1 Rhomboid 129..282 CDD:279958 43/160 (27%)
rhbdf2NP_001090673.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..78
Rhomboid_SP 90..287 CDD:372211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..180
Rhomboid 620..761 CDD:366759 44/162 (27%)
MFS 746..>803 CDD:391944 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253228at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.