DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rib and lolal

DIOPT Version :9

Sequence 1:NP_001261085.1 Gene:rib / 44855 FlyBaseID:FBgn0003254 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:132 Identity:49/132 - (37%)
Similarity:76/132 - (57%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QTYCLRWNNHQTNLVQILHALHEVGSYVDCSLVVDDEQFQAHRVVLAANSPYFQHILKDVPQDHC 80
            |.:.|:||:.|||:|.....|.:..|:.|.:|..:.:..:||::||:|.||||:.:|::.|..|.
  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHP 70

  Fly    81 SIILPGVKGFEIAALLQYMYTGETTVTKSQEPEILRTAKELQVKGLYDNLMKFNHASVTPTSSSG 145
            .|||..|....:.|:|::||.||..|::.|.|..|:||..|:||||.:          ||:|...
  Fly    71 IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE----------TPSSIKR 125

  Fly   146 AG 147
            .|
  Fly   126 EG 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ribNP_001261085.1 BTB 33..133 CDD:279045 37/99 (37%)
BTB 44..133 CDD:197585 35/88 (40%)
HTH_psq 373..417 CDD:283007
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10615
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.