DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rib and chinmo

DIOPT Version :9

Sequence 1:NP_001261085.1 Gene:rib / 44855 FlyBaseID:FBgn0003254 Length:680 Species:Drosophila melanogaster
Sequence 2:NP_001188680.1 Gene:chinmo / 33343 FlyBaseID:FBgn0086758 Length:840 Species:Drosophila melanogaster


Alignment Length:638 Identity:136/638 - (21%)
Similarity:206/638 - (32%) Gaps:227/638 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QTYCLRWNNHQTNLVQILHALHEVGSYVDCSLVVDDEQFQAHRVVLAANSPYFQHILKDVPQD-H 79
            |.:||:||:..:||......|.:.....|..|..|...|:||:::|||.|..|..:.::.|.: .
  Fly     5 QQFCLKWNSFSSNLAITFSNLFKSDLLADVILSCDGVVFKAHKLILAACSKKFADLFENTPTNGQ 69

  Fly    80 CSIILPGVKGFEIAALLQYMYTGETTVTKSQEPEILRTAKELQVKGLYDNLMKFNHASVTPTSSS 144
            |.|||.......:||||::||.||..|::......|::|:.||||||           .|.|...
  Fly    70 CVIILEATTPDNMAALLEFMYKGEVHVSQEALNSFLKSAESLQVKGL-----------STETGRL 123

  Fly   145 GAGGAKPQNGSASNHSSSVISTSTHISPSAAISSSCSPPPPPQFGYQPGYSHYPQQQPMSASQIP 209
            .|..|:...|..|...|.....|...|.|..                            |:|.:|
  Fly   124 AAQQAQQHMGDLSPLDSPTGRRSVRNSLSGG----------------------------SSSIVP 160

  Fly   210 AGEAPLTPTQATPHSAASGAG----------EAGGQWPLTPSAAAAMLNSVYESAADMNPLKRKK 264
            .|........||..::.||.|          .|||......:|||:.|:::   ||..|.:.|  
  Fly   161 GGVGIGLGGGATGANSMSGMGIGNGLSLAGMAAGGGMAAAANAAASSLSTL---AASANIVDR-- 220

  Fly   265 LSAISSMLLSGNRDTPILRNVLAQANPADSSQPGPMNANGEKTPTHPHQNTQLPAGLGVSGGERN 329
            ..:..:.::||           :.|....|...|..|.:|          |....|.||..|   
  Fly   221 CGSAGANIISG-----------SAAGIGGSHSGGAGNGSG----------TVGIGGNGVGSG--- 261

  Fly   330 HSFNGSDYGGDKEPLSPYTDRSFEEETGQSGGKKPEWKRYKQYTRADMMCAIQAVREGMSALQAS 394
                    ||:..|:|..:........|.|.|                     .:::...:|.  
  Fly   262 --------GGNNGPISLGSGAGAAHHLGGSTG---------------------ILKQECDSLM-- 295

  Fly   395 RKYGLPSRTLYDKVRKLNITTGRGTHRTPKRSPPGAESSQGFSYSAAAAAAAHNYGHGHGHHSEV 459
                                           .|.|:.||.|..|:                    
  Fly   296 -------------------------------HPGGSSSSSGMGYT-------------------- 309

  Fly   460 KRDQKVDHVPAHHGMPPTIPPSAAALLDHAFLQQALENRGGDM------------AGREALHAMA 512
                   |||..:......||...|::...:.:|  |.||..:            ..:...|..:
  Fly   310 -------HVPPIYRPINYEPPRKRAIVRSPYSEQ--EQRGSVLRDGSKSSECPSPINKPPYHRPS 365

  Fly   513 LAAAAHAAANRLSSSPAEMDQRSNGHGMRSPSPQGRHYPHEQEAMDLEMEKHE------------ 565
            .:|:        |::|.|.|..   |..|: |||...|           |.|.            
  Fly   366 SSAS--------STAPTEADTM---HSERA-SPQSSRY-----------ENHSPSTTAGNGNATS 407

  Fly   566 --QNIIKRERDQDEREDADDEE----DHEQEH-VEDLSLARKERPPSPYSPQP 611
              :.|:|.||:.....:|:|::    |...:: .|||   |.:.....|||.|
  Fly   408 SLERIVKSERNNGSANEANDDDRELMDESTDNGAEDL---RVKLENLKYSPPP 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ribNP_001261085.1 BTB 33..133 CDD:279045 34/100 (34%)
BTB 44..133 CDD:197585 33/89 (37%)
HTH_psq 373..417 CDD:283007 1/43 (2%)
chinmoNP_001188680.1 BTB 22..116 CDD:279045 32/93 (34%)
BTB 33..116 CDD:197585 31/82 (38%)
C2H2 Zn finger 519..540 CDD:275368
C2H2 Zn finger 547..568 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10373
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1229475at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.