DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and ECM23

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_015304.1 Gene:ECM23 / 856086 SGDID:S000005942 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:36 Identity:13/36 - (36%)
Similarity:20/36 - (55%) Gaps:1/36 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 GEGRECVNCGAISTPLWRRDGTGHY-LCNACGLYHK 198
            |:.:||..||...|..||....|:. ||:.||:.::
Yeast   127 GQPKECATCGDTWTSQWRSGPNGNVELCSRCGIAYR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 13/36 (36%)
ZnF_GATA 168..212 CDD:238123 12/32 (38%)
ZnF_GATA 223..270 CDD:214648
ZnF_GATA 226..276 CDD:238123
ECM23NP_015304.1 ZnF_GATA 127..178 CDD:214648 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.