Sequence 1: | NP_476685.1 | Gene: | pnr / 44849 | FlyBaseID: | FBgn0003117 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013856.1 | Gene: | GAT2 / 855167 | SGDID: | S000004744 | Length: | 560 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 271 | Identity: | 53/271 - (19%) |
---|---|---|---|
Similarity: | 92/271 - (33%) | Gaps: | 106/271 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SDQQSTRDYPHFSGDYQNVTLSAASASTSASASATHVAAVKMYHSSAVAAYTDLAAAGSAASAGV 76
Fly 77 --------------GVGVSGYHQQAVNAPVYVP--------------------SNRQYNH----- 102
Fly 103 ---------VAAHF------GSAAAQNAWTTEGFGSAHAQFYSPNAAVMMGSWRSAYDPSGFQRS 152
Fly 153 SPYESAMDFQFGEGRECVNCGAISTPLWRRDGTG-HYLCNACGLYH-----KMNGMNRPLIKPSK 211
Fly 212 RLVSATATRRM 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pnr | NP_476685.1 | ZnF_GATA | 164..212 | CDD:214648 | 17/53 (32%) |
ZnF_GATA | 168..212 | CDD:238123 | 17/49 (35%) | ||
ZnF_GATA | 223..270 | CDD:214648 | 53/271 (20%) | ||
ZnF_GATA | 226..276 | CDD:238123 | |||
GAT2 | NP_013856.1 | GAT1 | 25..551 | CDD:227928 | 53/271 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5641 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |