DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and Gata3

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_579827.1 Gene:Gata3 / 85471 RGDID:621250 Length:444 Species:Rattus norvegicus


Alignment Length:330 Identity:132/330 - (40%)
Similarity:170/330 - (51%) Gaps:73/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AASASTSASASATHVAAVKMYHSSAVAAYTDLAAAGSAASAGVGVGVSGYHQQAVNAPVYVPSNR 98
            |:|:|.:|..|:.|:..........|:....|:..|||.||...      .::.:...|.:|.:.
  Rat   136 ASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQD------EKECLKYQVQLPDSM 194

  Fly    99 QYNHVAAHFGSAAAQNAWTTEGFGSAHAQF-----------YS----PNAAVMMGSWRSAYDPSG 148
            :..       ::.::.:.||.|..|:.|..           ||    |.::::.||      |:|
  Rat   195 KLE-------TSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGS------PTG 246

  Fly   149 FQ-RSSPYESAMDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKR 212
            |. :|.|...:..    ||||||||||.||||||||||||||||||||||||||.|||||||.:|
  Rat   247 FGCKSRPKARSST----EGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRR 307

  Fly   213 LVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKRKP 277
            |   :|.||.|..|.||.|.||||||||.:|:|||||||||||||.:||||.|:|:|||||.||.
  Rat   308 L---SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKM 369

  Fly   278 KKTGSGSAVGAGTGSGTGSTLEAIKECKEEHD----------LKPSLSLERHSLSKLHTDMKSGT 332
            ....                    |:||:.||          ..|: :|.||..|..|....|.:
  Rat   370 SSKS--------------------KKCKKVHDALEDFPKSSSFNPA-ALSRHMSSLSHISPFSHS 413

  Fly   333 SSSST 337
            |...|
  Rat   414 SHMLT 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 43/47 (91%)
ZnF_GATA 168..212 CDD:238123 40/43 (93%)
ZnF_GATA 223..270 CDD:214648 33/46 (72%)
ZnF_GATA 226..276 CDD:238123 37/49 (76%)
Gata3NP_579827.1 ZnF_GATA 263..313 CDD:238123 43/52 (83%)
ZnF_GATA 317..367 CDD:238123 37/49 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.