DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and DAL80

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_012959.1 Gene:DAL80 / 853904 SGDID:S000001742 Length:269 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:37/96 - (38%)
Similarity:52/96 - (54%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LIKPSKRLVSATATRRMGL--C-------CTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNR 261
            ::..|.:|.|.|.:...|:  |       |.||.|..|.||||:..|..:||||||:.||||..|
Yeast     2 VLSDSLKLPSPTLSAAAGVDDCDGEDHPTCQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPR 66

  Fly   262 PLAMRKDGIQTRKRKPKKTGSGSAVGAGTGS 292
            |::::.|.|::|.|| |...:.....|.|.|
Yeast    67 PISLKTDTIKSRNRK-KLNNNNVNTNANTHS 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 1/5 (20%)
ZnF_GATA 168..212 CDD:238123 1/5 (20%)
ZnF_GATA 223..270 CDD:214648 25/55 (45%)
ZnF_GATA 226..276 CDD:238123 25/49 (51%)
DAL80NP_012959.1 GAT1 <1..269 CDD:227928 37/96 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.