DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and SRD1

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_009944.2 Gene:SRD1 / 850377 SGDID:S000000611 Length:221 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:30/128 - (23%)
Similarity:41/128 - (32%) Gaps:19/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PSNRQYNHVAAHFGSAAAQNAWTTEGFGSAHAQFYSPNAAVMMGSWRSAYDPSGFQRSSPYESAM 159
            ||..:............:|.|...||:.|. ||..|.:|::     ...|......|....:...
Yeast   100 PSKNRVTSACNSERRTTSQEANNLEGYHSC-AQGTSRSASI-----TKKYSKKTTSRPKREKRQT 158

  Fly   160 DFQFGEGRECVNCGAISTPLWRR-DGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATATRR 221
            ....||.:||..|....|..||. ......||:.|||.:            .|||......:|
Yeast   159 ILPNGEIKECSKCKDTWTIQWRSGPDQNRELCSPCGLAY------------GKRLKKENEKKR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 13/48 (27%)
ZnF_GATA 168..212 CDD:238123 11/44 (25%)
ZnF_GATA 223..270 CDD:214648
ZnF_GATA 226..276 CDD:238123
SRD1NP_009944.2 ZnF_GATA 163..214 CDD:214648 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.