DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and ARR7

DIOPT Version :10

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_173339.1 Gene:ARR7 / 838487 AraportID:AT1G19050 Length:206 Species:Arabidopsis thaliana


Alignment Length:58 Identity:19/58 - (32%)
Similarity:22/58 - (37%) Gaps:22/58 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 EAIKECKEEHDLKP-SLS-------------------LERHSLSKLHTDMKSGTSSSS 336
            |.:||..||..||| .|:                   |...:..||..|  |.|||||
plant   125 ECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQED--SDTSSSS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 168..212 CDD:238123
ZnF_GATA 226..276 CDD:238123
ARR7NP_173339.1 REC_typeA_ARR 26..147 CDD:381119 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.