DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and GNC

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_200497.1 Gene:GNC / 835788 AraportID:AT5G56860 Length:398 Species:Arabidopsis thaliana


Alignment Length:273 Identity:54/273 - (19%)
Similarity:81/273 - (29%) Gaps:114/273 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 HYLCNACGLYHKMN-------GMNRPLIKPSKRLVSATATRRMGL-------------CCTNCGT 231
            ||..|     ||.|       .:|...:...|...:.|..|...:             .|::|.|
plant   178 HYPLN-----HKTNFDEDHHEDLNFKNVLTRKTTAATTENRYNTINENGYSNNNGVIRVCSDCNT 237

  Fly   232 RTTTLWRRNNDG-EPVCNACGLYYKLHGVNRPLAMRKDGIQTRKRKPKKTGSGSAVGAG------ 289
            ..|.|||....| :.:|||||:                    |:||.::....:|..||      
plant   238 TKTPLWRSGPRGPKSLCNACGI--------------------RQRKARRAAMAAAAAAGDQEVAV 282

  Fly   290 -------------------TGSG-----TGSTLEAIKECK----EEHDLKPSLSLERHSLSKLHT 326
                               :..|     :...:...|:||    ||.:::.........:||..|
plant   283 APRVQQLPLKKKLQNKKKRSNGGEKYNHSPPMVAKAKKCKIKEEEEKEMEAETVAGDSEISKSTT 347

  Fly   327 DMKSGTSSSS------TLMGHHSAQQQQQQQQQQQQQQQQQQQQSAHQQCFPLYGQTTTQQQHQQ 385
            ...|..||:.      |:|                     ..:.||:||.||       |.:.:.
plant   348 SSNSSISSNKFCFDDLTIM---------------------LSKSSAYQQVFP-------QDEKEA 384

  Fly   386 HGHSMTSSSGQAH 398
            ....|..|.|..|
plant   385 AVLLMALSYGMVH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 7/31 (23%)
ZnF_GATA 168..212 CDD:238123 7/31 (23%)
ZnF_GATA 223..270 CDD:214648 13/60 (22%)
ZnF_GATA 226..276 CDD:238123 14/50 (28%)
GNCNP_200497.1 GAT1 <180..>259 CDD:227928 20/83 (24%)
ZnF_GATA 227..>263 CDD:214648 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.