DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and GATA9

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_195015.1 Gene:GATA9 / 829425 AraportID:AT4G32890 Length:308 Species:Arabidopsis thaliana


Alignment Length:248 Identity:53/248 - (21%)
Similarity:82/248 - (33%) Gaps:88/248 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DYPHFSGDYQNVTLSAASASTSASASATHVAAVKMYHSSAVAAYTDLAAAGSAASAGVGVGVSGY 83
            |:.:..|:..:...:...:||.::.:.|.       .|::.:.:||            |.|.|  
plant    25 DFSNDDGEVDDGLNTLPDSSTLSTGTLTD-------SSNSSSLFTD------------GTGFS-- 68

  Fly    84 HQQAVNAPVYVPSNR------QYNHVAAHFGS---------AAAQNAWTTEGFGSAHAQFYSP-- 131
                   .:|:|::.      ..|.|...|..         :..:|..||   ||.......|  
plant    69 -------DLYIPNDDIAELEWLSNFVEESFAGEDQDKLHLFSGLKNPQTT---GSTLTHLIKPEP 123

  Fly   132 ------------NAAV-----------MMGSWRSAY---------DPSGFQR---SSPYESAMDF 161
                        |.||           ...:|.|..         :|...||   ...:...||.
plant   124 ELDHQFIDIDESNVAVPAKARSKRSRSAASTWASRLLSLADSDETNPKKKQRRVKEQDFAGDMDV 188

  Fly   162 QFGE---GRECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLIKPS 210
            ..||   ||.|::|....||.||....| ..||||||:.:| :|...|..:|:
plant   189 DCGESGGGRRCLHCATEKTPQWRTGPMGPKTLCNACGVRYK-SGRLVPEYRPA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 21/51 (41%)
ZnF_GATA 168..212 CDD:238123 17/44 (39%)
ZnF_GATA 223..270 CDD:214648
ZnF_GATA 226..276 CDD:238123
GATA9NP_195015.1 ZnF_GATA 194..246 CDD:214648 19/48 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.