DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and MNP

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_566939.1 Gene:MNP / 824251 AraportID:AT3G50870 Length:295 Species:Arabidopsis thaliana


Alignment Length:270 Identity:53/270 - (19%)
Similarity:84/270 - (31%) Gaps:90/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 STSASASATHVAAVKMYHSSAVAAY--TDLAAAGSAASAGVGVGVSGYHQQAVNAPVYVPSNRQY 100
            :||......|...: .:|.|....|  .:.:.|||.:..        :..|  |..|:..:...|
plant     7 TTSTQGQYCHSCGM-FHHHSQSCCYNNNNNSNAGSYSMV--------FSMQ--NGGVFEQNGEDY 60

  Fly   101 NHVAA------HFGSAAA--------QNAWTTEGFGSAHAQFYSPNAAVMMGSWRSAYDPSGFQR 151
            :|.::      ..|:.:.        :...|:.|..|..:.|           |...:..:...:
plant    61 HHSSSLVDCTLSLGTPSTRLCEEDEKRRRSTSSGASSCISNF-----------WDLIHTKNNNSK 114

  Fly   152 SSPYESAMDFQFGE----------------------GRECVNCGAISTPLWRRDGTG-HYLCNAC 193
            ::||.:...|...:                      .|.|.||...||||||....| ..|||||
plant   115 TAPYNNVPSFSANKPSRGCSGGGGGGGGGGGGDSLLARRCANCDTTSTPLWRNGPRGPKSLCNAC 179

  Fly   194 GLYHKMNGMNRPLIKPSKRLVSATATRRMGL-------------------CCTNCGTRTTTLWRR 239
            |:..|         |..:|..:||....:|.                   ..||......|.|..
plant   180 GIRFK---------KEERRTTAATGNTVVGAAPVQTDQYGHHNSGYNNYHAATNNNNNNGTPWAH 235

  Fly   240 NNDGEPV-CN 248
            ::..:.| ||
plant   236 HHSTQRVPCN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 19/70 (27%)
ZnF_GATA 168..212 CDD:238123 18/44 (41%)
ZnF_GATA 223..270 CDD:214648 8/46 (17%)
ZnF_GATA 226..276 CDD:238123 7/24 (29%)
MNPNP_566939.1 ZnF_GATA 152..194 CDD:214648 20/50 (40%)
GATA 154..189 CDD:278735 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.