DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and GATA1

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_189047.1 Gene:GATA1 / 821990 AraportID:AT3G24050 Length:274 Species:Arabidopsis thaliana


Alignment Length:89 Identity:29/89 - (32%)
Similarity:44/89 - (49%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 GRECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLIKPSKRLVSATATRRMGLCCTNC 229
            ||:|.:|||..||.||....| ..||||||:.:| :|...|..:|:.   |.|.|..:.   :|.
plant   193 GRKCQHCGAEKTPQWRAGPAGPKTLCNACGVRYK-SGRLVPEYRPAN---SPTFTAELH---SNS 250

  Fly   230 GTRTTTLWR--RNNDGEPVCNACG 251
            ..:...:.:  ::.||:.....||
plant   251 HRKIVEMRKQYQSGDGDGDRKDCG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 21/46 (46%)
ZnF_GATA 168..212 CDD:238123 19/44 (43%)
ZnF_GATA 223..270 CDD:214648 5/31 (16%)
ZnF_GATA 226..276 CDD:238123 5/28 (18%)
GATA1NP_189047.1 ZnF_GATA 193..243 CDD:214648 23/53 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.