| Sequence 1: | NP_476685.1 | Gene: | pnr / 44849 | FlyBaseID: | FBgn0003117 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_062058.2 | Gene: | Gata6 / 29300 | RGDID: | 2666 | Length: | 587 | Species: | Rattus norvegicus |
| Alignment Length: | 440 | Identity: | 149/440 - (33%) |
|---|---|---|---|
| Similarity: | 178/440 - (40%) | Gaps: | 185/440 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 YQNVTLSAASASTSASASATHVAAVKMYHSSAVAAYTDLAAAGSAASAGVGVGVSGYHQQAVNAP 91
Fly 92 VYVPSNR--------QYNHVAA-----HFGSAAAQNAWTT-----------------------EG 120
Fly 121 FGSAHAQF---YSPNAAVMMGSWRSAYDPSGF--------------------------QRSS--- 153
Fly 154 ---------------------------------PYES--------------------AMDF--QF 163
Fly 164 GEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATATRRMGLCCTN 228
Fly 229 CGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKRKPKKTGSGSAVGA----- 288
Fly 289 ----------------------GTGSGTG-STLEAIKEC--KEEHDLKPS 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pnr | NP_476685.1 | ZnF_GATA | 164..212 | CDD:214648 | 39/47 (83%) |
| ZnF_GATA | 168..212 | CDD:238123 | 37/43 (86%) | ||
| ZnF_GATA | 223..270 | CDD:214648 | 36/46 (78%) | ||
| ZnF_GATA | 226..276 | CDD:238123 | 40/49 (82%) | ||
| Gata6 | NP_062058.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 17..73 | ||
| GATA-N | 147..371 | CDD:283099 | 45/251 (18%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 209..259 | 9/49 (18%) | |||
| ZnF_GATA | 382..429 | CDD:214648 | 40/46 (87%) | ||
| ZnF_GATA | 383..428 | CDD:238123 | 38/44 (86%) | ||
| ZnF_GATA | 435..482 | CDD:214648 | 36/46 (78%) | ||
| ZnF_GATA | 437..488 | CDD:238123 | 40/50 (80%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 480..532 | 12/51 (24%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 69 | 1.000 | Domainoid score | I9383 |
| eggNOG | 1 | 0.900 | - | - | E1_COG5641 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 223 | 1.000 | Inparanoid score | I3434 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000130 | |
| OrthoInspector | 1 | 1.000 | - | - | otm44697 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR10071 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X1091 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 9 | 9.010 | |||||