Sequence 1: | NP_476685.1 | Gene: | pnr / 44849 | FlyBaseID: | FBgn0003117 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506480.1 | Gene: | end-3 / 191631 | WormBaseID: | WBGene00001311 | Length: | 242 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 52/203 - (25%) |
---|---|---|---|
Similarity: | 78/203 - (38%) | Gaps: | 39/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 QNAWTTEGFGSAHAQ-------FYSPNAAVMMGSWRSAYDPS------------GFQRSSPYESA 158
Fly 159 MDFQFG-EGRECVNCGAISTPL--WRRDGTGHYLCNACGLYHKM------NGMN----------R 204
Fly 205 PLIKPSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDG 269
Fly 270 IQTRKRKP 277 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pnr | NP_476685.1 | ZnF_GATA | 164..212 | CDD:214648 | 11/66 (17%) |
ZnF_GATA | 168..212 | CDD:238123 | 11/61 (18%) | ||
ZnF_GATA | 223..270 | CDD:214648 | 21/46 (46%) | ||
ZnF_GATA | 226..276 | CDD:238123 | 22/49 (45%) | ||
end-3 | NP_506480.1 | ZnF_GATA | 178..229 | CDD:238123 | 22/50 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5641 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2600 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000130 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.760 |