DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and end-3

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_506480.1 Gene:end-3 / 191631 WormBaseID:WBGene00001311 Length:242 Species:Caenorhabditis elegans


Alignment Length:203 Identity:52/203 - (25%)
Similarity:78/203 - (38%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 QNAWTTEGFGSAHAQ-------FYSPNAAVMMGSWRSAYDPS------------GFQRSSPYESA 158
            |..:..||:|:....       .:.|...:...|:...||.|            |:...: |:..
 Worm    29 QVQFNEEGYGTPSPDVLQNMNYHHYPAQDMTTNSYNGGYDNSMQQNFMQPDNGAGYYNEN-YQQM 92

  Fly   159 MDFQFG-EGRECVNCGAISTPL--WRRDGTGHYLCNACGLYHKM------NGMN----------R 204
            .||||. :..:..|....:||:  .::..|.....|.....:.|      .|.|          :
 Worm    93 PDFQFPVQNFDFTNQFEFTTPINDLQQSQTSINHTNPDNNENSMPEIPIDGGFNFFPAQEVQEWK 157

  Fly   205 PLIKPSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDG 269
            |..|.||..:...:|..:...|:|||.|.|.|||||..||..||.|.||.::.|..||..:....
 Worm   158 PARKASKNKIKKISTMHINSSCSNCGCRETKLWRRNEQGETECNPCNLYERVKGHKRPQHLWNKP 222

  Fly   270 IQTRKRKP 277
            ...|:|:|
 Worm   223 AAKRRRRP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 11/66 (17%)
ZnF_GATA 168..212 CDD:238123 11/61 (18%)
ZnF_GATA 223..270 CDD:214648 21/46 (46%)
ZnF_GATA 226..276 CDD:238123 22/49 (45%)
end-3NP_506480.1 ZnF_GATA 178..229 CDD:238123 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2600
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.