DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and end-1

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_506475.1 Gene:end-1 / 179893 WormBaseID:WBGene00001310 Length:221 Species:Caenorhabditis elegans


Alignment Length:139 Identity:41/139 - (29%)
Similarity:67/139 - (48%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 AYDPSGFQRSSPYESAMDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLI 207
            :|||:  |:|:|...    .|| ..:.:||.:...|...:|            |.:....|.|.:
 Worm    73 SYDPA--QQSTPVHP----MFG-SLDMMNCYSQQYPQIGQD------------YQQQEIENIPPV 118

  Fly   208 KPSKRLVS-ATATRRMGLCCT--NCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDG 269
            ..::::|: ..:|......|:  ||.||.||||||.:.|...||.|.||::.:|:.||..:.:..
 Worm   119 STNRKIVNKKPSTFHTNSVCSNPNCRTRETTLWRRTDSGAIECNGCSLYFRKNGIQRPAELCRKT 183

  Fly   270 IQTRKRKPK 278
            |..|.|:|:
 Worm   184 IMKRNRRPR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648 8/47 (17%)
ZnF_GATA 168..212 CDD:238123 7/43 (16%)
ZnF_GATA 223..270 CDD:214648 20/48 (42%)
ZnF_GATA 226..276 CDD:238123 22/51 (43%)
end-1NP_506475.1 GAT1 <80..>221 CDD:227928 37/130 (28%)
ZnF_GATA 137..190 CDD:238123 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.