DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pnr and elt-6

DIOPT Version :9

Sequence 1:NP_476685.1 Gene:pnr / 44849 FlyBaseID:FBgn0003117 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_500144.2 Gene:elt-6 / 176993 WormBaseID:WBGene00001253 Length:367 Species:Caenorhabditis elegans


Alignment Length:102 Identity:38/102 - (37%)
Similarity:53/102 - (51%) Gaps:14/102 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 CTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKRKPKKTGSGSAVG--- 287
            |:||.|..||.|||:.:|:.|||||||||:||..:||:.||||.||.|.|:..:.....|..   
 Worm   265 CSNCSTIKTTAWRRDLEGKLVCNACGLYYRLHRTHRPVHMRKDFIQQRFRRRMREDENPATSQAA 329

  Fly   288 -----------AGTGSGTGSTLEAIKECKEEHDLKPS 313
                       |..|:...:.||.|.:..:..:.:.|
 Worm   330 VFSQLLGLPSMANGGANALTFLEQINQLNQSQEQRKS 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pnrNP_476685.1 ZnF_GATA 164..212 CDD:214648
ZnF_GATA 168..212 CDD:238123
ZnF_GATA 223..270 CDD:214648 27/43 (63%)
ZnF_GATA 226..276 CDD:238123 30/49 (61%)
elt-6NP_500144.2 GAT1 <254..>367 CDD:227928 38/102 (37%)
ZnF_GATA 264..315 CDD:238123 30/49 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.