DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pnr and ZGLP1

DIOPT Version :9

Sequence 1:	NP_476685.1	Gene:	pnr / 44849	FlyBaseID:	FBgn0003117	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001096637.1	Gene:	ZGLP1 / 100125288	HGNCID:	37245	Length:	271	Species:	Homo sapiens

Alignment Length:	113	Identity:	31/113 - (27%)
Similarity:	42/113 - (37%)	Gaps:	37/113 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   143 AYDPSGFQRSSPYESAMDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLI 207
            |..|.|.:..|....|:     |.|.|.:|....|||||....|..||||||:.:|
Human   185 AAHPGGTEAHSAGSEAL-----EPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYK--------- 235

  Fly   208 KPSKRLVSATATRRMGLCCTNCGTRTTTLW---RRNNDGEPVCNACGL 252
                                ..|||.::.|   |:|...:.:|..||:
Human   236 --------------------KYGTRCSSCWLVPRKNVQPKRLCGRCGV 263

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pnr	NP_476685.1	ZnF_GATA	164..212	CDD:214648	17/47 (36%)
		ZnF_GATA	168..212	CDD:238123	15/43 (35%)
		ZnF_GATA	223..270	CDD:214648	9/33 (27%)
		ZnF_GATA	226..276	CDD:238123	9/30 (30%)
ZGLP1	NP_001096637.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	18..40
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	96..141
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	170..199		4/13 (31%)
		ZnF_GATA	202..>240	CDD:214648	18/66 (27%)
		GATA	206..240	CDD:278735	16/62 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5641
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810