powered by:
Protein Alignment pnr and Zglp1
DIOPT Version :9
Sequence 1: | NP_476685.1 |
Gene: | pnr / 44849 |
FlyBaseID: | FBgn0003117 |
Length: | 540 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096638.1 |
Gene: | Zglp1 / 100009600 |
MGIID: | 3696042 |
Length: | 266 |
Species: | Mus musculus |
Alignment Length: | 51 |
Identity: | 24/51 - (47%) |
Similarity: | 32/51 - (62%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 PSKRLVSATATRRMG-LCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHG 258
|||.|.|..::..:| ..|.:|.|:.|.|||...||.|:|||||:.||.:|
Mouse 179 PSKALASPGSSEALGPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYG 229
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5641 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.