DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment plu and C01F1.6

DIOPT Version :9

Sequence 1:NP_476683.1 Gene:plu / 44848 FlyBaseID:FBgn0003114 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_494753.3 Gene:C01F1.6 / 173761 WormBaseID:WBGene00015301 Length:456 Species:Caenorhabditis elegans


Alignment Length:75 Identity:24/75 - (32%)
Similarity:36/75 - (48%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VCTMARDGKQHNLEDVDMYGNTALLKACYLGRFECARTLLEFGANIFAMNYFGQNALTLATYAGH 85
            :..:.|.|:  :|.:.|.:|||||..|..||..|....||...|.:...|..|.|.|..:...|.
 Worm    40 IVQLLRAGR--SLSEKDTHGNTALHIATMLGHREAIAILLANNAPVRIKNIDGWNPLMESVSYGD 102

  Fly    86 LTLVKELLRR 95
            ..::.|:||:
 Worm   103 RQIITEMLRK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pluNP_476683.1 ANK <32..124 CDD:238125 22/64 (34%)
ANK repeat 39..70 CDD:293786 12/30 (40%)
Ank_4 40..93 CDD:290365 18/52 (35%)
C01F1.6NP_494753.3 ANK repeat 27..54 CDD:293786 3/15 (20%)
Ank_2 28..112 CDD:372319 23/73 (32%)
ANK repeat 56..87 CDD:293786 12/30 (40%)
GPCR_chapero_1 172..447 CDD:371788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.