DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hmg20a and Dsp1

DIOPT Version :9

Sequence 1:NP_001006760.1 Gene:hmg20a / 448440 XenbaseID:XB-GENE-955353 Length:345 Species:Xenopus tropicalis
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:305 Identity:66/305 - (21%)
Similarity:114/305 - (37%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


 Frog     5 ASAAPPSSEDLVVDTKENAEPPFCGISLSGSSQAPFHPQSPTLQQDERDELILQQSGEQQLGNSG 69
            |:||.|.|:.......:..........|....|.....|....||.::.:.:.||..:|.:.||.
  Fly   107 AAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSA 171

 Frog    70 ELRQEEELPKTRRGGWTKGRKRKRSPRDNNAPKAPLTGYVRFMNERREQLRTERPD--VPFPEIT 132
            .       |.:|             .:.:..|:..:|.|..|:...||:.:.:.||  |.|.|.:
  Fly   172 S-------PMSR-------------VKADAKPRGRMTAYAYFVQTCREEHKKKHPDETVIFAEFS 216

 Frog   133 RIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQNTDAYQTYSRKAQSRQKGRQQRQEGVRG 197
            |.....|..:...||:.:.:.|||||:||..|:|.|        ...|.....:|::::|.....
  Fly   217 RKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQNY--------VPPKGAVVGRGKKRKQIKDPN 273

 Frog   198 VP----------INTEKESILKERPIFDIPIFTEEFLNHSKAREAELRQLRKSNMEFE----ERN 248
            .|          .|.|:..:....|.|.:....:|........:.|::|..:|..|.:    ||.
  Fly   274 APKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYERE 338

 Frog   249 AALQKHVESMRSAVQRLEAELNQEQERNSLL-----QQHLQSVRQ 288
            ....|....:..:...::|.:..:.::.:||     |||.|...|
  Fly   339 MTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hmg20aNP_001006760.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..124 23/118 (19%)
NHP6B 48..>181 CDD:227935 34/134 (25%)
HMGB-UBF_HMG-box 101..166 CDD:238686 23/66 (35%)
SMC_prok_A <141..322 CDD:274009 36/167 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..198 4/30 (13%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 24/69 (35%)
HMGB-UBF_HMG-box 275..339 CDD:238686 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3288
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.