DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and qsm

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:444 Identity:92/444 - (20%)
Similarity:143/444 - (32%) Gaps:163/444 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SLEVMCGKDHMDVHLTF--------SHP---FEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISY 103
            |.:|.|.:|.|.|.:..        |.|   .||:   || :.|.||   .|....:...||:|.
  Fly    26 SHKVHCSEDQMRVDIGLPDAESKDQSAPQIYLEGL---KG-YPDERC---QPQIDGSLAVFRLSL 83

  Fly   104 SRCGTKPDLNGQFYENTVV----------VQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVI 158
            |          .|||..|.          |.|.|.::                 |.|:.|.   |
  Fly    84 S----------DFYECGVTRMVNQLTGKKVYYHKIII-----------------ESTSGKE---I 118

  Fly   159 ADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSGI--------VPLG----------STLT---- 201
            ..:..|.......||  .|....|....:....||        :|.|          ::||    
  Fly   119 VSVKCITTASPAYNV--MMNATTGSSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTSLTKRAP 181

  Fly   202 ---LVVAINDYRGEF--DMRVKSCV-------ASDGSGHVINLSDEF----------------GC 238
               |.:.::....:|  |:.|||..       ..:.|..|..|...:                ||
  Fly   182 EPRLSIGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSETLIFKGC 246

  Fly   239 VLRPKMISRFLKARAPDERATV---ITYAFFHAFKFPDALSVHIKCKVEICRHGCL-DHCQNTGV 299
            .:.|.:...|         .|:   |..|.|.||||||:..|..:..|.:|...|| ..|.|..|
  Fly   247 TVDPYLFENF---------NTIDGDILSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNNQV 302

  Fly   300 GGGGGGSGESLGLGLGLGLTNANERKDVHMS------DALGSSSNDLLRDLALPPGGQHGMGMGM 358
            |.|....          .:::||:..::.::      |..|.:.|::|:                
  Fly   303 GFGRRKR----------EISSANKVYEISLAMFLQVQDIEGVNKNEVLQ---------------- 341

  Fly   359 GPDHDIFYEDIIHDHKQTLGGGGMPAGGDYGHEKS-VNLQPRPVHEEQEEADLS 411
                   .|:.:.:.|.........:.|::..|:: .:.||..|.:|:|...||
  Fly   342 -------LEEKLRELKLANQRLARNSRGNFAMEQTPASAQPAFVVDERELGHLS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 65/304 (21%)
Zona_pellucida <194..287 CDD:278526 29/137 (21%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 68/315 (22%)
Zona_pellucida <200..300 CDD:278526 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.