DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and nyo

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_651871.2 Gene:nyo / 43716 FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster


Alignment Length:378 Identity:85/378 - (22%)
Similarity:136/378 - (35%) Gaps:77/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYS--RCGTKPD 111
            ||:|  |....|...:..|..|:|.|.:||.   |:...|..:.... |.||:.|:  .|..:..
  Fly   379 VSIE--CRSGEMITKIRTSKLFDGKVYAKGA---PKSCAVNVNNSLE-FDFRMGYNDLECNVRQS 437

  Fly   112 LNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDV---------IQLD 167
            ..|: |.|.:|:|:...::...|....:.|:    |:.|..   .|:.|:|:         :..:
  Fly   438 AYGR-YMNDIVIQHHDMIVTSSDLGLAVSCQ----YDLTNK---TVLNDVDLGVTGEIESSLSEE 494

  Fly   168 FRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGSGHV-IN 231
            ...|:.:..|:|....|   ..:..:..:|..|.|...|.:....:::.|:..||.|||... |.
  Fly   495 ITIDSPNVIMKITSRDG---SDMKRMAEVGDPLALRFEIVEPNSPYEIFVRELVAMDGSDSAEIT 556

  Fly   232 LSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHCQN 296
            |.|..||.....::....|  ....|..:::.  |.|||||.:..|..:..|.    .|:..|:.
  Fly   557 LIDANGCPTDQYIMGTIQK--LAQNRKVLLSQ--FDAFKFPSSEVVQFRALVT----PCIPRCEP 613

  Fly   297 TGVGGGGGGSGESLGLGLGLG---------------LTNANERKDV-------------HMSDAL 333
            .......|.|||...| :..|               |.:...|:||             .::|..
  Fly   614 VICDSEDGASGELKSL-VSYGRKKRSVLNGTDGAEFLISTRHRRDVGPVDDNILLMQSIQITDKF 677

  Fly   334 GSSSNDLLRDLALPPGGQHGMGMGMGPDHDIFYEDIIHDHKQTLGGGGMPAGG 386
            |..          |..|....|...|| |:..|..:..|....|.|.|:...|
  Fly   678 GFQ----------PEDGTTTHGNDSGP-HEKAYAGVAQDKLTCLNGYGLIMAG 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 56/242 (23%)
Zona_pellucida <194..287 CDD:278526 25/93 (27%)
nyoNP_651871.2 PAN_1 121..198 CDD:278453
PAN_AP_HGF 208..286 CDD:238532
PAN_1 295..374 CDD:278453
ZP 382..618 CDD:214579 59/260 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
21.910

Return to query results.
Submit another query.