DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and mey

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001287622.1 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster


Alignment Length:359 Identity:76/359 - (21%)
Similarity:133/359 - (37%) Gaps:62/359 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTF-FSFRISYSRCGTKPDLN 113
            ::.:.|....|...:..|..|:|.|.:||.   |:...|..:....| ...|.:...|..:....
  Fly   403 NVSIDCRSGEMITKIRTSKLFDGKVYAKGA---PKSCAVNVNNSLEFDLKMRYNDLECNVRQSAY 464

  Fly   114 GQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDV-------IQLDFRGD 171
            |: |.|.:|:|:...::...|....:.|:    |:.| :|..:...||.|       :..:...|
  Fly   465 GR-YMNDIVIQHHDMIVTSSDLGLAVSCQ----YDLT-NKTVVNNVDLGVTGEIESTLSEEIIVD 523

  Fly   172 NVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGSGHV-INLSDE 235
            :.:..|:|....|   ..:..|..:|..|.|...|.|....:::.|:..||.||:... |.|.|.
  Fly   524 SPNVIMKITARDG---SDMKRIAEVGDPLALRFEIVDANSPYEIFVRELVAMDGTDSAEITLIDA 585

  Fly   236 FGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHCQNTGVG 300
            .||.....::|...|  ..:.|..:::.  |.|||||.:..|..:..|.    .|:..|:.....
  Fly   586 NGCPTDQYIMSAMQK--LANNRKVLLSQ--FDAFKFPSSELVQFRALVT----PCIPRCEPVICD 642

  Fly   301 GGGGGSGESL------------GL-GLGLGLTNANERKDVHMSDALGSSSNDLLRDLALPPGGQH 352
            ....|..:||            |. |:.|.:.:..:::|| ...|.|..:..|::.:.:.     
  Fly   643 NDENGELKSLLSYGRRKRSVLNGTDGVELAIKSERQKRDV-SHQAAGDENILLVQSIQIT----- 701

  Fly   353 GMGMGMGPDHDIFYEDIIHDHKQTLGGGGMPAGG 386
                          :....:.....||.|..|||
  Fly   702 --------------DKFAFNGADAPGGSGSEAGG 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 57/239 (24%)
Zona_pellucida <194..287 CDD:278526 26/93 (28%)
meyNP_001287622.1 PAN_1 146..223 CDD:278453
PAN_AP_HGF 233..311 CDD:238532
PAN_AP_HGF 319..>380 CDD:238532
ZP 408..642 CDD:214579 59/253 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
21.910

Return to query results.
Submit another query.