DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and CG17111

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:331 Identity:72/331 - (21%)
Similarity:110/331 - (33%) Gaps:66/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LRFSSCIFILHLMFSLVIAGNELWPMERPDGMPNIVSLE--VMCGKDHMDVHLTFSHPFEGIVSS 76
            |..|.|  :||....:.:....|...|....|..:..|:  |.|.:|.|.:.......|.|.:.:
  Fly   313 LSLSEC--LLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYA 375

  Fly    77 KGQHSDPRCVYVPPSTGKTFFSFRI----SYSRCG------TKPDLNGQFYENTVVVQYDKDLLE 131
            .....|  |:......|....:.:|    ..:|||      ...:....|....||:|.:.::..
  Fly   376 SMHSKD--CLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQT 438

  Fly   132 VWDEAKRLRCEWFN----------DYEKTASKP-PMVIA---DLDVIQLDFRGDNVDCWMEIQHG 182
            ..|...::.|...|          |....:|:| |..||   .|:..:..|..:.|   :.....
  Fly   439 QGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGV---VHYNSS 500

  Fly   183 KGPWAPPVSGI-------------VPLGSTLTLVVAINDYRGEF-------------DMRVKSCV 221
            .||...|...:             |.:|..|.|.: :.:|..:.             |.|..|.|
  Fly   501 TGPHPHPSISLQILDLSHQHETNDVQIGQNLELQI-VAEYSPQQLAEHMELQLAPLPDFRATSLV 564

  Fly   222 A--SDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVE 284
            |  :|....|: |.||.||   |...|.|.........:..:..|.||||||....:|....|:.
  Fly   565 AKTADNENFVL-LIDERGC---PTDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIR 625

  Fly   285 ICRHGC 290
            .|...|
  Fly   626 FCVERC 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 60/282 (21%)
Zona_pellucida <194..287 CDD:278526 29/107 (27%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.