DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and matn1

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001093210.1 Gene:matn1 / 403023 ZFINID:ZDB-GENE-050307-3 Length:489 Species:Danio rerio


Alignment Length:325 Identity:64/325 - (19%)
Similarity:107/325 - (32%) Gaps:122/325 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GMPNIVSLEVMCG---KDHMDV--------HLT--FSHPFEGIVS---SKGQHS-DPRCVYVPPS 91
            |..::.:|..|..   :||:|.        .||  |...|..:||   :.|.|. :..|:..|.|
Zfish   177 GRVDMTTLRQMASEPLEDHVDYVESYSLIEKLTKKFQEAFCAVVSDLCATGDHDCEHICISTPGS 241

  Fly    92 ------TGKTFFSFRISYSRCGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKT 150
                  .|.|..:...|.|.|....                .|::.:.|.:|.:|.|.|...:|.
Zfish   242 FKCACREGFTLMNDSRSCSACSNAA----------------TDVVFLIDGSKSVRPENFELVKKW 290

  Fly   151 ASKPPMVIADLDVIQLDFRGDNVDCWMEIQH-GKGPWAPPVSGIVPLG---STLTLVVAIN--DY 209
            .:   ::|..|||.:.:            .| |...::..|....|||   |..:|..|:.  ||
Zfish   291 IN---LIIDKLDVSETN------------THVGLVQYSSTVKQEFPLGRHNSKRSLKEAVKRMDY 340

  Fly   210 --RGEFDMRVKSCVASDGSGHVIN--LSDEFGCVLRPKMISR---------FLKARAPD------ 255
              ||..            :||.::  :.:.||    |...:|         |...|:.|      
Zfish   341 MERGTM------------TGHALSFLVDNSFG----PNQGARPGVPKVGIVFTDGRSQDYIGDAA 389

  Fly   256 ERATVI---TYA----------------------FFHAFKFPDALSVHIKCKVEICRHGCLDHCQ 295
            ::|..:   .||                      :|:...|.....:..|.::.:|:..  |.|:
Zfish   390 KKAKALGFKMYAVGVGNAVEDELREIASEPIADHYFYTADFKTMNQIAKKLQINVCQEE--DPCE 452

  Fly   296  295
            Zfish   453  452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/303 (19%)
Zona_pellucida <194..287 CDD:278526 25/141 (18%)
matn1NP_001093210.1 vWA_Matrilin 35..258 CDD:238752 19/80 (24%)
vWA_Matrilin 265..489 CDD:238752 42/237 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.