DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and Matn3

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001382499.1 Gene:Matn3 / 313954 RGDID:1305085 Length:481 Species:Rattus norvegicus


Alignment Length:189 Identity:41/189 - (21%)
Similarity:59/189 - (31%) Gaps:69/189 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AGNELWP--MERPDGMPNIVSLEVMCGK---DH-----------------------MDVHLTFSH 68
            :|.||:.  ::|.|    :.||::|..|   ||                       :|..:..:|
  Rat   208 SGIELYAVGVDRAD----MESLKMMASKPLEDHVFYVETYGVIEKLSARFQETFCALDQCMLGTH 268

  Fly    69 PFEGIVSSKG---QHSDPRCVYVPPSTGKTFFSFRISYSRCGTKP---------DLNGQF----Y 117
            ..:.:..|.|   .|.:....|...:.|||..:.    .:|....         |.||.:    |
  Rat   269 QCQHVCVSDGDGRHHCECSQGYTLNADGKTCSAI----DKCALNTHGCEQICVNDRNGSYHCECY 329

  Fly   118 E--------NTVVVQYDKDLLE--------VWDEAKRLRCEWFNDYEKTASKPPMVIAD 160
            |        .|...| ||..|.        |.|.|....||.|..|...|.|....:.|
  Rat   330 EGYTLNADRKTCAAQ-DKCALGTHGCQHICVNDGAGSHHCECFEGYTLNADKKTCSVRD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 33/164 (20%)
Zona_pellucida <194..287 CDD:278526
Matn3NP_001382499.1 vWFA 75..298 CDD:412136 18/93 (19%)
FXa_inhibition 305..341 CDD:405372 6/35 (17%)
FXa_inhibition 347..383 CDD:405372 10/35 (29%)
FXa_inhibition 389..425 CDD:405372
Matrilin_ccoil 438..478 CDD:402147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.