DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and Matn1

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:XP_038965345.1 Gene:Matn1 / 297894 RGDID:1359410 Length:523 Species:Rattus norvegicus


Alignment Length:273 Identity:56/273 - (20%)
Similarity:83/273 - (30%) Gaps:100/273 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRG 170
            |.|:|                .||:.|.|.::.:|..   ::||.......||..|||      |
  Rat    57 CRTRP----------------TDLVFVVDSSRSVRPV---EFEKVKVFLSQVIKSLDV------G 96

  Fly   171 DNV--------------DCWMEIQHGKGPWAPPVSGIVPLGS-TLT-------LVVAINDYRG-- 211
            .|.              :..:.....|......|..|.||.: |:|       :..|::|..|  
  Rat    97 PNATRVGLVNYASTVKPEFPLRAHTSKASLLQAVHRIQPLSTGTMTGLALQFAITKALSDAEGGR 161

  Fly   212 --EFDMRVKSCVASDG--SGHVINLSDE----------FGCVLRPKMISRFLKARAPDERATVI- 261
              ..|:.....|.:||  ...|.::|:.          .|.....|...|.:.:...||....: 
  Rat   162 SRSSDISKVVIVVTDGRPQDSVRDVSERARASGIELFAIGVGRVDKATLRQIASEPQDEHVDYVE 226

  Fly   262 TYAFFH--AFKFPDALSVHIKCKVEICRHGCLDH-CQNTGVG----------------------- 300
            :|....  |.||.:|.     |..::|..|  || |:...|.                       
  Rat   227 SYNVIEKLAKKFQEAF-----CVSDLCATG--DHYCEQVCVSSPGSYTCACHEGFTLNSDGKTCN 284

  Fly   301 ---GGGGGSGESL 310
               |||.||...|
  Rat   285 VCRGGGNGSATDL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 44/220 (20%)
Zona_pellucida <194..287 CDD:278526 24/119 (20%)
Matn1XP_038965345.1 vWA_Matrilin 60..282 CDD:238752 48/253 (19%)
vWFA 293..497 CDD:412136 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.