DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and Matn4

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001100009.1 Gene:Matn4 / 296358 RGDID:1309732 Length:624 Species:Rattus norvegicus


Alignment Length:200 Identity:45/200 - (22%)
Similarity:69/200 - (34%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KTASKPPM-----VIADLDVIQ---LDFRGD--NVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLV 203
            :..:.||:     ::...|:||   |.|:|.  ..|...|::||.........|        |..
  Rat   184 RAMASPPLDQHVFLVESFDLIQEFGLQFQGRLCGKDLCAELEHGCQHLCVNAPG--------TFY 240

  Fly   204 VAIND-YRGEFDMRVKSCVASD-------GSGHVINLSDEFGCVLRPKMISRFLKARA-----PD 255
            .|.|. |:...|.|  :|:|.|       |..|:        ||  ..:.|.|.:.||     .|
  Rat   241 CACNSGYKLAPDNR--NCLAIDLCAEGTHGCEHL--------CV--SSVDSYFCRCRAGFALQQD 293

  Fly   256 ERA-TVITYAFF--HAFK--------------------FPDALSVHIKCKVEICR---HGCLDHC 294
            :|: ..|.|..|  |:.:                    .||..|..::   :.|.   |||...|
  Rat   294 QRSCRAIDYCSFGNHSCQHECVSTLVGPQCRCREGHDLLPDGRSCQVR---DFCNGVDHGCEFQC 355

  Fly   295 QNTGV 299
            .:.|:
  Rat   356 VSEGL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 39/182 (21%)
Zona_pellucida <194..287 CDD:278526 26/128 (20%)
Matn4NP_001100009.1 vWA_Matrilin 33..255 CDD:238752 19/80 (24%)
FXa_inhibition 262..297 CDD:291342 10/44 (23%)
FXa_inhibition 303..338 CDD:291342 4/34 (12%)
FXa_inhibition 344..379 CDD:291342 6/16 (38%)
vWFA 385..621 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.