DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-19

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_871693.1 Gene:cutl-19 / 191090 WormBaseID:WBGene00022533 Length:237 Species:Caenorhabditis elegans


Alignment Length:234 Identity:45/234 - (19%)
Similarity:72/234 - (30%) Gaps:93/234 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CVYVPPSTGKTFFSFRISYS-----RCGTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCE-- 142
            ||.|..||     :.:..||     :.|.:.::....|||...:          ......||.  
 Worm     9 CVLVIFST-----TIKCEYSELMNQKIGVRVEVLNMIYENETTI----------TSTGHPRCRLT 58

  Fly   143 -----WFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTL 202
                 |..|   |.|.|            .|:.::...|                     ||...
 Worm    59 LHKSGWDRD---TCSSP------------QFKLNDTLSW---------------------STRVC 87

  Fly   203 VVAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFH 267
            ...:.| ..::.|||:||.....:..|..|.|: ||.:               |:| ::|...:.
 Worm    88 YKWVCD-TTKYAMRVESCWIGSPNMSVYILRDD-GCTI---------------EKA-ILTSPVYT 134

  Fly   268 AFKFPDALS-----------VHIKCKVEICRHGCLDHCQ 295
            :|....|:.           :|:.|.:.:| |.|...||
 Worm   135 SFNRAAAIGWMAVRQKNMKYMHVGCTIRLC-HLCDPKCQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 40/223 (18%)
Zona_pellucida <194..287 CDD:278526 20/103 (19%)
cutl-19NP_871693.1 ZP <17..171 CDD:214579 38/218 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.