DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-23

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001317785.1 Gene:cutl-23 / 189610 WormBaseID:WBGene00021343 Length:773 Species:Caenorhabditis elegans


Alignment Length:257 Identity:53/257 - (20%)
Similarity:94/257 - (36%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDGMPNI-VSLEVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYSR 105
            ||..|.: .:.:|.|.:..|.:.:......:|::.:...|.:|.|: :..:..........:..:
 Worm   439 PDAKPQVRGATDVKCTEHSMSIVVRTQRALQGVMYAHMYHDEPECM-IRKTDNSREIQMTFTEGK 502

  Fly   106 CG----TKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQL 166
            ||    ...|.:|..:..||::|:...::...|:...:.|       ..:|..|....|..|:: 
 Worm   503 CGLVKTPTADGHGYHFNITVILQFHPLIITRADQGLDMSC-------FVSSAVPRQELDRAVLK- 559

  Fly   167 DFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGSGHVIN 231
              ...:..|...: |...| ...|:....:|.||....|. |...|::..|..|.. ....|...
 Worm   560 --NAADTQCVYRL-HRYSP-GQCVALDAKVGETLYHRWAC-DSPPEYNYLVHDCFV-QSEKHTQQ 618

  Fly   232 LSDEFGC-----VLRPKMISRFLKARAPDERATVITYAF--FHAFKFPDALSVHIKCKVEIC 286
            :.|..||     .|.....|||  ...|::     :|.|  ...||||....:...||:.:|
 Worm   619 ILDSNGCEVDQHFLETPNYSRF--KDYPED-----SYVFQEMSVFKFPGDGDLLFHCKISLC 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 48/241 (20%)
Zona_pellucida <194..287 CDD:278526 26/100 (26%)
cutl-23NP_001317785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.