DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-6

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_492000.2 Gene:cutl-6 / 189075 WormBaseID:WBGene00012165 Length:374 Species:Caenorhabditis elegans


Alignment Length:311 Identity:64/311 - (20%)
Similarity:119/311 - (38%) Gaps:66/311 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILHLMFSLVIAGNELWPMERPDGMPNIVSL---------EVMCGKDHMDVHLTFSHPFEGIVSSK 77
            :|.|.|.||.:     .:|:..|...:|:.         :|:|.::.:.:.:..|.||.|.:..|
 Worm     2 LLRLGFLLVCS-----MLEKVIGQTKVVNYIDNSIIGTPKVICAENDLALDIVTSKPFRGNIFVK 61

  Fly    78 GQHSDPRCVYVPPSTGKTFFSFRISYSRCGTK----PDLNGQFYENTVVVQY-DKDLLEVWDEAK 137
            |:..|..|.....:.|..  |:.:...:||.:    .:..|..:..||:|.: ....:...|.|.
 Worm    62 GRAKDKSCRQSYANNGTN--SYSLPLGKCGMQRLRSANPRGVNFMVTVIVSFHPAGFITKNDRAF 124

  Fly   138 RLRCEWFNDYEKTASKPPMVIA---DLDVIQLDFRGDNV---DCWMEIQHGKGPWAPPVSGIVPL 196
            .::|.:.        :|..::.   |:.:|......|::   .|...::...           |.
 Worm   125 HVKCFYM--------EPDEIVTQNIDVSMIPTTELSDSMVMPKCEYSVRRDG-----------PN 170

  Fly   197 GSTLTLVVAINDY--------RGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARA 253
            |.||| ...:.|.        ..:..|.||.|..:||.|....:.|..||...|     ||.:..
 Worm   171 GPTLT-YANVGDIVFHVWECTPADMGMLVKKCFVTDGDGEDHAVVDFDGCATDP-----FLLSEL 229

  Fly   254 PDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHCQ-----NTGV 299
            ..:.:.:..:|....||:.|:..::..|::.:|:.. :..||     |.||
 Worm   230 SYDASLMRAHASSQVFKYADSNQLYFTCQIRLCQKQ-MGMCQEVTPPNCGV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 49/249 (20%)
Zona_pellucida <194..287 CDD:278526 24/100 (24%)
cutl-6NP_492000.2 ZP 38..280 CDD:214579 55/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.