DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cut-5

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_001257100.1 Gene:cut-5 / 187677 WormBaseID:WBGene00011104 Length:395 Species:Caenorhabditis elegans


Alignment Length:279 Identity:57/279 - (20%)
Similarity:106/279 - (37%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VMCGKDHMDVHLTFS----------------HPFEGIVSSKGQHSDPRC-VYVPPSTGKTFFSFR 100
            |.||.|..:|::..|                ..|.|:...:....:|.| .:...:......|.|
 Worm    30 VECGDDFFEVNIYHSCSCVGNFIIKVKFDTRTTFHGLAFVQNHLDNPDCRSFASKTDSAKNSSLR 94

  Fly   101 ISYSRC------GTKPDLNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIA 159
            :::.:|      .|.|  .|.|....|||.::.:.|...|...:::| ::.:.|:...|      
 Worm    95 LTFDQCAIEKRHSTSP--RGLFLSTNVVVAFNPEFLTKNDRVFKVQC-FYMEMERRIQK------ 150

  Fly   160 DLDVIQLDFRGDNVD--------CWMEIQHGKGPWAPPVSGIVPLGSTLTLVV-----AINDYRG 211
               |||:......:.        |..|:..| .|..|||     ..:|:..:|     ...::..
 Worm   151 ---VIQISMPPPTMHSKQLNMPVCKYEVLDG-SPTGPPV-----YFATVGQMVYHKWTCDTEHEN 206

  Fly   212 EFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALS 276
            .|.|.|.||...||:|..:.|.::.||.|...:::..      :....::.....|.:|:.|..:
 Worm   207 TFCMLVHSCFVDDGNGQRVQLLNDKGCALDKYLLTNL------EYPTDLMAGREAHVYKYADRDN 265

  Fly   277 VHIKCKVEI-CRHGCLDHC 294
            ::..|::.| .:...||:|
 Worm   266 MYFDCQISITVKEPGLDYC 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 53/267 (20%)
Zona_pellucida <194..287 CDD:278526 19/98 (19%)
cut-5NP_001257100.1 Zona_pellucida 53..290 CDD:421542 51/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.