DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-3

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_510492.2 Gene:cutl-3 / 184721 WormBaseID:WBGene00008978 Length:405 Species:Caenorhabditis elegans


Alignment Length:311 Identity:63/311 - (20%)
Similarity:109/311 - (35%) Gaps:94/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYSRC------GTKPD 111
            :.||.:.:.::......|||.|..||.:|...|  ...:|.::..:..:|||.|      .:.| 
 Worm    32 IRCGSESLSINFKTQGAFEGHVYVKGHYSMKHC--RTDATLESQVNLTVSYSACDVIRQRSSNP- 93

  Fly   112 LNGQFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCW 176
             .|.....|:::.:....:...|::.:::| ::.:.:||.::           ||     |||..
 Worm    94 -KGIMMTATIIISFHPMFITKIDKSYKVQC-FYAEAQKTVTQ-----------QL-----NVDIA 140

  Fly   177 ME----------------IQHGKG-----------PWAPPVSGIVP--------LGSTLTLVVAI 206
            .|                :.|..|           .....:|..||        |..:.|..||.
 Worm   141 KEQEKKIFVMVGDEEGGTVSHTTGDQKKLHKLNDPSTEERISYNVPLPDCKYRVLTESKTEEVAF 205

  Fly   207 -----------------NDYRGEFDMRVKSCVASDGSGHVINLSDEFGCVLRPKMISRFLKARAP 254
                             .:....|.:.|.||...|.:|..:.:.||.||.:...:|:..      
 Worm   206 ATVGQIVYHEWSCEAPGQNQTSPFCVTVHSCNVKDETGKEVQIFDENGCAVDKYLINNL------ 264

  Fly   255 DERATVITYA-FFHAFKFPDALSVHIKCKVEICRH----GCL---DHCQNT 297
             |.::.:|.. ....|||.|..||..:||:.:...    .|:   |||..|
 Worm   265 -EYSSDLTGGQLSQVFKFADQPSVFFQCKIRLGLKEEDGSCIRSSDHCPAT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/289 (20%)
Zona_pellucida <194..287 CDD:278526 27/118 (23%)
cutl-3NP_510492.2 ZP 33..306 CDD:214579 59/300 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.