DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cut-4

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_496242.2 Gene:cut-4 / 184037 WormBaseID:WBGene00008482 Length:507 Species:Caenorhabditis elegans


Alignment Length:260 Identity:61/260 - (23%)
Similarity:102/260 - (39%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EVMCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYSRCGTK--PDLNG 114
            ||:|....:.:.....:.|.|.|..||..|:|.|:.|  ..|||...|.:.:..||.:  .::||
 Worm    40 EVVCETASISLLFKTRNSFNGKVFVKGYVSEPSCMTV--GDGKTGHRFEVRHDSCGVRRQREING 102

  Fly   115 QFYENTVVVQYDKDLLEVWDEAKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGDNVDCWMEI 179
            .....||::.:....:...|.|.|:.|.:....:|..:.  :.|:.|....|:.......|..||
 Worm   103 VVISATVIISFHSIFITKIDRAYRVSCFYVEGTKKVHNH--VDISALTTQLLESETQLPVCRYEI 165

  Fly   180 QHGKGPWAPPVSGIVPLGSTL----TLVVAINDYRGEFDMRVKSCVASDG-SGHVINLSDEFGC- 238
            .:..|  ..|:. ...:|..:    |.|..:.:.   :.|:|.||...|| .|..:.:.|..|| 
 Worm   166 LNEAG--GSPIK-YARIGDQVYHKWTCVAELENV---YCMKVHSCTVYDGQGGPPVTVIDANGCS 224

  Fly   239 ----VLRPKMISRFLKA--RAPDERATVITYAFFHAFKFPDALSVHIKCKVEICRHGCLDHCQNT 297
                :|:....:..|.|  .||             .|||.|...::..|::::........|.||
 Worm   225 VDGVILQNLEYTSDLTAGKLAP-------------VFKFADKAGLYFNCQIQLTIKDVNYGCSNT 276

  Fly   298  297
             Worm   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 56/244 (23%)
Zona_pellucida <194..287 CDD:278526 23/104 (22%)
cut-4NP_496242.2 ZP 43..283 CDD:214579 59/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3815
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X161
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.