DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-14

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_492780.2 Gene:cutl-14 / 182018 WormBaseID:WBGene00015231 Length:270 Species:Caenorhabditis elegans


Alignment Length:283 Identity:69/283 - (24%)
Similarity:107/283 - (37%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PDGMPNIVSLEVMCGKDHMD-VHLTFSHPFEGIVSSKGQHSDPRCVYVPPSTGKTFFSFRISYSR 105
            |:|:  :.::||.|....:: |.||.:: |.|.|...|...|..|  |...||:...|..:...:
 Worm    22 PNGL--LGNVEVECTDTTIEAVFLTETN-FLGRVFVLGHSQDKDC--VSRETGRRTTSITVPRDK 81

  Fly   106 CGTKPDLNGQ-----FYENTVVVQYDKDLLEVWDEAKRLRCEW-----FNDYEKTASKPPMVIAD 160
            ||.:...:|:     ...|.|:..:||.|.:| |.|..:.|.:     ...|..|..  |.::.|
 Worm    82 CGVETVQHGKGAGYTSSVNIVISFHDKFLTKV-DRAYNITCLYAPTGDVVSYALTVQ--PSLLKD 143

  Fly   161 LDVIQLDFRGDNVDCW-----------MEIQHGKGP----WAPPVSGIVPLGSTLTLVVAINDYR 210
            :.|:     .:...|.           .||.|...|    |...       |:.|.|        
 Worm   144 IQVL-----AEQPSCEYEVFDVRTRRPAEIVHVNAPLEHVWTCD-------GTNLDL-------- 188

  Fly   211 GEFDMRVKSCVASDG-SGHVINLSDEFGCVLRPKMISRFLKARAPDER-------ATVITYAFFH 267
              |.|.|..||.::| |.....:.|..||.|.        ..|.|:.|       |.|::    .
 Worm   189 --FCMTVHDCVINEGKSKRRSKIIDSEGCSLD--------TTRLPNLRYENNKLSARVMS----K 239

  Fly   268 AFKFPDALSVHIKCKVEI-CRHG 289
            ||:|.|.::|..:|.|.: .|:|
 Worm   240 AFRFGDDVAVEFECNVRLDLRNG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 63/265 (24%)
Zona_pellucida <194..287 CDD:278526 26/101 (26%)
cutl-14NP_492780.2 ZP 32..270 CDD:214579 65/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5383
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.