DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and cutl-18

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_505875.2 Gene:cutl-18 / 179565 WormBaseID:WBGene00009830 Length:801 Species:Caenorhabditis elegans


Alignment Length:326 Identity:75/326 - (23%)
Similarity:118/326 - (36%) Gaps:94/326 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DLRFSS-CIFILHLMFSLVIAGNELWPMERPDGMPNIVSLEVMCGKDHMDVHLTFSHPFEGIVSS 76
            |::.|: |.|  ..:...|..||       ||. .|:|..|:.....|.:...|.....|.|:  
 Worm   468 DVKISTQCTF--GFISVKVSPGN-------PDN-HNLVGGEIYVRNGHSNCSKTIGTDGEAIL-- 520

  Fly    77 KGQHSDPRCVYVPPSTGKTFFSFRISYSRCGTKPDLNGQFYENTVVVQYDKD------LLEVWDE 135
            |.:|:|..|:                     ||   ||..||..|||..:.:      ::.:.|:
 Worm   521 KIRHNDTTCI---------------------TK---NGDIYETVVVVTQNVESVGNATVITIDDQ 561

  Fly   136 AKRLRCEWFNDYEKTASKPPMVIADLDVIQLDFRGD-NVDCWMEIQHGKGPWAPPVSG------- 192
            ..::||::.|.....|....|.:......:||..|. ||.          |.:..:.|       
 Worm   562 LFKVRCDYSNQKNAVAVAKTMNLRTTQFNKLDIYGKVNVK----------PMSMELRGKREIIKA 616

  Fly   193 -IVPLGSTLTLVVAINDYRGEFDMRVKSCVASDGSGHVINLSDEFGC--------VLRPKMISRF 248
             .|.||.:|.||..:::......:.||.|.|.|.:|....:..:.||        |||.::    
 Worm   617 RTVKLGQSLDLVFTVDNSTSARHVFVKKCTAYDQNGDEKIILIKNGCATQHAKEYVLRDEI---- 677

  Fly   249 LKARAPDERATVITYAFFHAFKFPDALSVHIKCKVEIC-------------RHGCLDHCQNTGVG 300
                  .|.||..... |.||:|....:|.|:|:|:.|             |....|..::|.:.
 Worm   678 ------KETATGFVLP-FRAFRFKQGEAVKIECEVKYCEKCKKANCPSRNRRFTTFDESEDTTLT 735

  Fly   301 G 301
            |
 Worm   736 G 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/253 (23%)
Zona_pellucida <194..287 CDD:278526 29/113 (26%)
cutl-18NP_505875.2 PAN_AP_HGF 105..177 CDD:238532
PAN_AP 187..258 CDD:214680
ZP 474..719 CDD:214579 69/301 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.