DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment m and noah-2

DIOPT Version :9

Sequence 1:NP_572747.1 Gene:m / 44835 FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster
Sequence 2:NP_502699.1 Gene:noah-2 / 178365 WormBaseID:WBGene00009926 Length:741 Species:Caenorhabditis elegans


Alignment Length:292 Identity:63/292 - (21%)
Similarity:102/292 - (34%) Gaps:91/292 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MCGKDHMDVHLTFSHPFEGIVSSKGQHSDPRCVYV-----------PPSTGKTFFSFRISYSRCG 107
            :|..:.:...:....|:.|.:.:..:.|  .|..|           ||.|        :| |.||
 Worm   391 LCTNEGIRFIVNTKEPYTGAIYAAERFS--TCSQVVENAKQISITFPPPT--------VS-SDCG 444

  Fly   108 TKPDLNGQFYENTVVVQYD----KDLLEVWDEAKRLRCEWFND-------------YEKTA---- 151
            |.  :.....|..|||..|    ..:...||...|:.|:...|             ||.::    
 Worm   445 TV--IRDGKMEALVVVSLDGVLPHQVTTEWDRFYRVSCDVSMDKMVKEGSVVVTTIYEASSQNTT 507

  Fly   152 ----SKPPMVIADLDVI-QLDFRGDNVDCWMEIQHGKGPWAPPVSGIVPLGSTLTLVVAINDYRG 211
                :.||.|.|:|.:: ||:          |..|.           ..:|..|.||:. ::..|
 Worm   508 VLDVATPPPVSAELQILNQLE----------EPLHK-----------ASIGDPLLLVIT-SEQAG 550

  Fly   212 EFDMRVKSCVAS--DGSGHVINLS-DEFGCVLRPKMI----SRFLKARAPDERATVITYAFFHAF 269
            ..:|.|..|.|:  .|.|..:..: .|.||...|.::    ..|.|.|...:         ..||
 Worm   551 PHNMMVTECTATRVGGFGDTVPFTLIENGCPRYPALVGPVEQDFDKNRLKSD---------LRAF 606

  Fly   270 KFPDALSVHIKCKVEICR--HGC-LDHCQNTG 298
            :...:..|.|.|.:..|.  :|| :.:|.::|
 Worm   607 RLDGSYDVQIVCSIMFCAGPNGCPVSNCLDSG 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mNP_572747.1 ZP 55..286 CDD:214579 58/274 (21%)
Zona_pellucida <194..287 CDD:278526 23/99 (23%)
noah-2NP_502699.1 PAN_1 28..112 CDD:278453
PAN_AP_HGF 125..203 CDD:238532
PAN_AP_HGF 217..292 CDD:238532
PAN_1 310..382 CDD:278453
ZP 392..634 CDD:214579 61/285 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.